PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G131000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 333aa    MW: 36078.9 Da    PI: 10.3326
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G131000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-1961108148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                          rg+WT+eEd +l+++v+++G g+W+++ ++ g+ R++k+c++rw ++l
  Manes.03G131000.1.p  61 RGPWTAEEDAILAEYVRKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 108
                          89******************************************9986 PP

2Myb_DNA-binding41.14.2e-13114157146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g+++ eE+ l++  ++++G++ W++ a+ ++ gRt++++k++w++
  Manes.03G131000.1.p 114 KGAFSLEEERLIAGFHAKWGNK-WARMASLLP-GRTDNEIKNYWNT 157
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.38156112IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2457111IPR009057Homeodomain-like
SuperFamilySSF466897.11E-3059155IPR009057Homeodomain-like
SMARTSM007178.2E-1760110IPR001005SANT/Myb domain
PfamPF002499.6E-1861108IPR001005SANT/Myb domain
CDDcd001672.75E-1363108No hitNo description
Gene3DG3DSA:1.10.10.601.1E-21112161IPR009057Homeodomain-like
SMARTSM007173.4E-12113161IPR001005SANT/Myb domain
PROSITE profilePS5129415.542113163IPR017930Myb domain
PfamPF002492.6E-12114157IPR001005SANT/Myb domain
CDDcd001676.67E-9116157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MMSASNGGSE GGGGGGDDDF AAAAATNQGA GRDMHANVHH DGSGKGGNGN GDGNGETHLK  60
RGPWTAEEDA ILAEYVRKHG EGNWNAVQKH SGLSRCGKSC RLRWANHLRP NLKKGAFSLE  120
EERLIAGFHA KWGNKWARMA SLLPGRTDNE IKNYWNTRVK RHQRRGIPLY PPDIQPQHPS  180
SPHFHHHRSS SSCITPTTPT SSFTFPTPHP LAPTSATPPH LSLTTPSTSF PTLPLFDFSQ  240
PPHHHHTSHS TPTTPTSSFS FHTQLPSPSH AHIQNAASSV SPLSSPSTNA STNFPTLPLF  300
DFSIPRTLPV LQTPMRFKRF SSSPNMATVT TTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31551611106B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158164VKRHQRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070848.11e-116PREDICTED: transcriptional activator Myb
TrEMBLA0A067L3R91e-121A0A067L3R9_JATCU; MYB family protein
STRINGPOPTR_0013s13450.19e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.16e-65myb domain protein 101